PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00032287-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 505aa    MW: 53459.1 Da    PI: 9.5304
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00032287-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.44.3e-15424474555
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v +L++eN++Lkk+  e+ + 
  PSME_00032287-RA 424 RRQRRMIKNRESAARSRARKQAYTVELEAEVNQLKEENMKLKKQQAEMAER 474
                       79****************************************765555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-14417476No hitNo description
SMARTSM003388.6E-16420484IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323422474IPR004827Basic-leucine zipper domain
PfamPF001705.6E-13424476IPR004827Basic-leucine zipper domain
CDDcd147071.43E-26424478No hitNo description
SuperFamilySSF579591.38E-10424473No hitNo description
PROSITE patternPS000360427442IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
VVFEIAETVD VIEFAIDILH QSRVMVSSHS AMTPALQGGP KMGGFPLARQ ASIYSLTLDE  60
FQNSLGEPGK NFGSMNMDEF LKNIWTAEES QAVAAAMGAV EGGNGVNLQR QGSLQRQGSL  120
TLPRTLSRRT VDDVWREIHK ESGDVNGSAP AGQARQPTFG EMTLEDFLVK AGVVREDSEQ  180
GAAQQSFGAF RSALEGEFHA NMAERNGDNR LGIGNSLGLG FSERGHRNGE VGNNKSGAGG  240
VSALSLSPTN VIPNHATMDM VNLDAFKHQQ QQTDWLNNHY RNATAAALAQ QQHQQQQQQL  300
LNHQAAAEAA AAYATNVKMV GGNAALMGQG GLGGGLALGG TMGNGGLGAG LGGVGGLGAG  360
LGGAFGPSAL AMGAGSPVSP LSSDGVGPSH LDNPTISPVP YGLDGGMRGR KRGLDGPVEK  420
VVERRQRRMI KNRESAARSR ARKQAYTVEL EAEVNQLKEE NMKLKKQQAE MAERRKKQIL  480
EVAAPMAKQL AAKTRPLRRT LTGPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ9135221e-173HQ913522.1 Pinus taeda ABI5-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011628985.11e-105PREDICTED: bZIP transcription factor TRAB1 isoform X2
SwissprotQ9M7Q51e-45AI5L4_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 4
TrEMBLA0A0C9S8B30.0A0A0C9S8B3_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11777_3031 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.17e-41abscisic acid responsive element-binding factor 1